http://download.uyesiz.com/file.php?f=1 Karaoke Builder Studio 3.0.080 Karaoke Builder proudly announces the next evolution of karaoke - Karaoke Builder Studio 3.0! All the features you could ever want from CD+G karaoke software, and some that you'd never believe possible! Prepare to be dazzled! Karaoke Builder Studio is available now, and there is no other software which will give you the ability to make such professional quality CD+G tracks. And what's more, we've made it EASY! “ The first professional-quality CD+G software available. Easy to use for the first-timer, but loaded with features to keep you happy! The only CD+G software to let you create karaoke tracks as good as or better than the discs you sing along with at your karaoke events! Tracks created with Karaoke Builder Studio will play in any karaoke CD+G machine Karaoke hosts can create their own tracks Singers can bring along their own songs Professionals can (and are) using Karaoke Builder Studio to master their own commercial-quality CD+G discs karaokebuilderproudlyannouncesthenextevolutionofkaraokekaraokebuilderstudio30allthefeaturesyoucouldeverwantfromcdgkaraokesoftwareandsomethatyoudneverbelievepossiblepreparetobedazzledkaraokebuilderstudioisava weekly 1.0 http://download.uyesiz.com/file.php?f=2 That New Look v1.0 That New Look Image Maker (TNL) is a imaging software. With TNL software you will be able to change your body shape, breast size, hairstyle, eyes, glasses, nose. All from comfort and privacy of your own home. he imaging process consists of loading or acquiring a photo of your body, face, or both; using photo-correction and face- or body-blending functions; setting control points for the hair style, glasses, breasts, and nose; modeling hair styles, eyebrows, and glasses; applying virtual make up; resizing the breasts; and modifying the body shape. “ That New Look Image Maker enables you to adjust the brightness, contrast, and hue of your BMP or JPG image; flip it horizontally; zoom in and out; and use brush, scissors, pencil, eye dropper, and comb tools. Imaging process consists of following important steps: • Taking Photo of your body and face in front views or downloading pictures from the files. • Photo correction and face/body blending; • Face type analysis and setting control points for hairstyles, glasses, breast, noses. • Hairstyles trying; • Eyebrows modeling • Virtual make up • Eyeglasses and sunglasses trying; • Breast resizing • Body shape changing thatnewlookv10 weekly 1.0 http://download.uyesiz.com/file.php?f=3 Minutes Matter Studio 2.3.4Minutes Matter Studio is a package purchase which includes studio 2.0 and studio planner. Easily create custom window treatment illustrations and design floor plans all while working within a single program. Explore the endless possibilities of digital re minutesmatterstudioisapackagepurchasewhichincludesstudio20andstudioplannereasilycreatecustomwindowtreatmentillustrationsanddesignfloorplansallwhileworkingwithinasingleprogramexploretheendlesspossibilitiesofdigitalre weekly 1.0 http://download.uyesiz.com/file.php?f=97 madness combatbest flash movie for you bestflashmovieforyou weekly 1.0 http://download.uyesiz.com/file.php?f=4 Abyssmedia Audio Converter Plus 3.10 Abyssmedia Audio Converter Plus is a powerful, professional solution designed for converting the most popular audio formats and Audio CD tracks directly into MP3, WMA, OGG, AMR or WAV formats. High quality 32-bit converter engine allows you to convert to any sampling rate and can create 24-bit and 32-bit WAV files for DVD Audio mastering. Intergration with Windows Explorer enables one-click conversion for any audio file or folder abyssmediaaudioconverterplusisapowerfulprofessionalsolutiondesignedforconvertingthemostpopularaudioformatsandaudiocdtracksdirectlyintomp3wmaoggamrorwavformatshighquality32bitconverterengineallowsyoutoconvertto weekly 1.0 http://download.uyesiz.com/file.php?f=5 AdiondjDecks is a computer mixing program for both beginning and djdecksisacomputermixingprogramforbothbeginningandprofessionaldjsmixyourmp3oggwmaflacwavfilesoraudiocdseasilyonanyconfigurationdjdecksisallyouneedtogetstartedandbecomeadjdjdecksoffersyouuptothreedec weekly 1.0 http://download.uyesiz.com/file.php?f=91 ZC Dream Photo Editor 2008 v2.71ZC Dream Photo Editor makes you easily blend your digital photo onto another picture (a landscape picture) in any size. You can also add some pretty frames, flowers, cartoon, jewelry, icon pictures, or write your comments on the photo to make it more beautiful and attractive. 220 masks, 100 kinds of flowers, 110 cartoon pictures, 40 jewelry pictures, 50 icons, 187 frames for you to add to your photo zcdreamphotoeditormakesyoueasilyblendyourdigitalphotoontoanotherpicturealandscapepictureinanysizeyoucanalsoaddsomeprettyframesflowerscartoonjewelryiconpicturesorwriteyourcommentsonthephototomakeitmorebeau weekly 1.0 http://download.uyesiz.com/file.php?f=92 2 Pack Flash Websites ( 4 )Two Great Flash Comercial Templates Made from one of the better design teams in the world scene: Layout Galaxy from India. Flash Templates full of sound, amazing designs, colour taste and spectacular movement. Very fast loading. The pack contain itself full instructions on how modify everything with ease from text to graphics in a few mouse clicks. Design difficulty Normal * Full website demo working in .swf * .fla full editable on Macromedia Flash * .swf background sound * Full instructions on HTML twogreatflashcomercialtemplatesmadefromoneofthebetterdesignteamsintheworldscenelayoutgalaxyfromindiaflashtemplatesfullofsoundamazingdesignscolourtasteandspectacularmovementveryfastloadingthepackcontainitselffu weekly 1.0 http://download.uyesiz.com/file.php?f=93 2 Pack Flash Websites ( 3 )Two Great Flash Comercial Templates Made from one of the better design teams in the world scene: Layout Galaxy from India. Flash Templates full of sound, amazing designs, colour taste and spectacular movement. Very fast loading. The pack contain itself full instructions on how modify everything with ease from text to graphics in a few mouse clicks. Design difficulty Normal * Full website demo working in .swf * .fla full editable on Macromedia Flash * .swf background sound * Full instructions on HTML twogreatflashcomercialtemplatesmadefromoneofthebetterdesignteamsintheworldscenelayoutgalaxyfromindiaflashtemplatesfullofsoundamazingdesignscolourtasteandspectacularmovementveryfastloadingthepackcontainitselffu weekly 1.0 http://download.uyesiz.com/file.php?f=94 2 Pack Flash Websites ( 2 )Two Great Flash Comercial Templates Made from one of the better design teams in the world scene: Layout Galaxy from India. Flash Templates full of sound, amazing designs, colour taste and spectacular movement. Very fast loading. The pack contain itself full instructions on how modify everything with ease from text to graphics in a few mouse clicks. Design difficulty Normal * Full website demo working in .swf * .fla full editable on Macromedia Flash * .swf background sound * Full instructions on HTML twogreatflashcomercialtemplatesmadefromoneofthebetterdesignteamsintheworldscenelayoutgalaxyfromindiaflashtemplatesfullofsoundamazingdesignscolourtasteandspectacularmovementveryfastloadingthepackcontainitselffu weekly 1.0 http://download.uyesiz.com/file.php?f=95 2 Pack Flash Websites ( 1 )Two new Great Flash Comercial Templates Made from one of the better design teams in the world scene: Layout Galaxy from India. Flash Templates full of sound, amazing designs, colour taste and spectacular movement. Very fast loading. The pack contain itself full instructions on how modify everything with ease from text to graphics in a few mouse clicks. Design difficulty Normal * Full website demo working in .swf * .fla full editable on Macromedia Flash * .swf background sound * Full instructions on HTML twonewgreatflashcomercialtemplatesmadefromoneofthebetterdesignteamsintheworldscenelayoutgalaxyfromindiaflashtemplatesfullofsoundamazingdesignscolourtasteandspectacularmovementveryfastloadingthepackcontainitsel weekly 1.0 http://download.uyesiz.com/file.php?f=6 REAPER 2.020 REAPER is a powerful but sensible Windows application that lets you record, arrange, edit, and render multi-track waveform audio. It provides an extensive set of features, but is a very small and lightweight application (the installer is less than 1 megabyte, and includes many effects and a sample project). REAPER supports ASIO, Kernel Streaming, WaveOut, and DirectSound for playback and recording. It reads WAV, OGG, and MP3 files, and records WAV files. You can arrange any number of items in any number of tracks and use audio processing plug-ins (DirectX and Jesusonic). REAPER also supports volume, pan controls and envelopes per track, multi-layer undo/redo, and user creatable color themes. reaperisapowerfulbutsensiblewindowsapplicationthatletsyourecordarrangeeditandrendermultitrackwaveformaudioitprovidesanextensivesetoffeaturesbutisaverysmallandlightweightapplicationtheinstallerislessthan1megab weekly 1.0 http://download.uyesiz.com/file.php?f=7 Winamp 5.51 Pro Nullsoft Winamp is a fast, flexible, high-fidelity media player for Windows. Winamp supports playback of many audio (MP3, OGG, AAC, WAV, MOD, XM, S3M, IT, MIDI, etc) and video types (AVI, ASF, MPEG, NSV), custom appearances called skins (supporting both classic Winamp 1.x/2.x skins and Winamp 3 freeform skins), audio visualization and audio effect plug-ins (including two industry dominating visualization plug-ins), an advanced media library, Internet radio and TV support, CD ripping, and CD burning. nullsoftwinampisafastflexiblehighfidelitymediaplayerforwindowswinampsupportsplaybackofmanyaudiomp3oggaacwavmodxms3mitmidietcandvideotypesaviasfmpegnsvcustomappearancescalledskinssupportingbothc weekly 1.0 http://download.uyesiz.com/file.php?f=8 Voice Changer Software AV VCS 4.0.54 Voice changing program for voice chat rooms and PC-to-Telephone connections. Ideal for Internet Users. Change the voice in real time, high-quality and natural voice output to any other`s voice (baby, girl, boy, old man, old woman, robot… voice). By adjusting the pitch and timbre level to make your voice deeper or thinner, male or female, you can have a changed voice output with top secret, safe and funny. Voice Changer Software AV VCS with its DirectX support is a special program for Voice Chat Rooms (AOL Instant Messenger (AIM), Yahoo! Messenger (YIM), MSN Messenger, ICQ, Paltalk, Odigo, Trillian, NetMeeting…), Voice Enabled Instant Messengers, Voice E-mail applications, online voice games (using with Roger Wilco, Microsoft Game Voice…), Audio Video Conferencing and PC-to-Telephone programs (Net2Phone, Dialpad, Go2Call, DeltaThree, MaxPhone…) as well as Media, Players, Recorders and DVD, CD, Karaoke Players. Apart from other voice changers, Voice Changer Software changes your voice over internet in real time and acquires unlimited number of new voices. You can modify voice by changing voice pitch and voice timbre, applying effects, adjusting advanced tuner, and setting equalizer. By changing your voice to any voice of male, female, teen, baby…, you can disguise your voice in voice chat, PC phone, online gaming, voice mail, voice messages. You can try different tones to enhance your voice for better sex appeal or better impression. Voice Changer Software helps you make many different voices for movie, cartoon, story telling, presentation, audio story. It also changes voice of music, add effects for listening or recording to new file. Voice changer Software has a sound recorder, which allows you to record voice, sound, audio from any source including microphone, internet radio, chat, phone, message, media player, karaoke singing… Voice Changer Software now has Voice Comparator to compare your changed voice with another’s voice. It tells you how successful you are done and what need further adjustment to imitate or simulate that target voice. Voice Changer Software is quite simple to use with various presets available for you to pick and apply: audio effects, “nickvoices”, and equalizer settings. Also, you have more control over the software such as exclude certain audio streams or application out of modifying process and manage you list of “nickvoice” effects, equalizer And........ keygen not working But Keygen on the down download link working voicechangingprogramforvoicechatroomsandpctotelephoneconnectionsidealforinternetuserschangethevoiceinrealtimehighqualityandnaturalvoiceoutputtoanyothersvoicebabygirlboyoldmanoldwomanrobotvoicebyadjust weekly 1.0 http://download.uyesiz.com/file.php?f=9 Ashampoo Music Studio 3.30 SK Do you like music? Do you use a computer? Then you need Ashampoo Music Studio 3. This program always been a favorite of digital music fans and the latest version now includes everything you need to create, edit and manage your digital music collection. And using it is nearly as simple as operating a CD player. doyoulikemusicdoyouuseacomputerthenyouneedashampoomusicstudio3thisprogramalwaysbeenafavoriteofdigitalmusicfansandthelatestversionnowincludeseverythingyouneedtocreateeditandmanageyourdigitalmusiccollectionan weekly 1.0 http://download.uyesiz.com/file.php?f=10 RealPlayer v11 Build 6.0.14.738 The free RealPlayer 10.5 is the first product that integrates Real's revolutionary new Harmony technology. RealPlayer enables consumers to buy and download music that plays on more than 100 portable devices, including the Apple iPod. RealPlayer is the only digital-media player you need for finding and downloading new music, playing and managing audio and video clips, and taking your digital entertainment with you. RealPlayer offers a streamlined interface that allows you to keep your media library close at hand. Keep all your digital-media clips organized in one place; save CD tracks with one click; pause and rewind live streams; transfer music to CDs and portable devices effortlessly; and enjoy clear, smooth video playback and multichannel, surround-sound support. thefreerealplayer105isthefirstproductthatintegratesrealsrevolutionarynewharmonytechnologyrealplayerenablesconsumerstobuyanddownloadmusicthatplaysonmorethan100portabledevicesincludingtheappleipodrealplayeristheonl weekly 1.0 http://download.uyesiz.com/file.php?f=11 iTunes v7.5 Tunes 7.5 features the ability to activate iPhone wherever service is offered and support for Phase, a new interactive music game designed exclusively for iPod nano (third generation), iPod classic, and iPod (fifth generation). This release also includes bug fixes to improve stability and performance. weekly 1.0 http://download.uyesiz.com/file.php?f=12 Karaoke Sound Tools v1.07 Retail Karaoke Sound Tools lets you remove vocal, adjust key and tempo of karaoke songs. Karaoke Sound Tools is an easy to use software package for karaoke audio processing. If you use a karaoke BIN or MP3+G file and use tempo changer, the graphics part of the song will be adjusted so the lyrics are in sync with slower or faster version of the song. No other software has this feature. Here are some key features of “Karaoke Sound Tools”: · Vocal remover to remove vocal parts from CD recordings · Control the amount of bass and treble processing · Remove vocals from non-centered recordings using balance · Adjust vocal removing level and output attenuation · Key changer to adjust the song to singers voice · change the pitch in -12 to +12 semitone (half-note steps) range · after processing, music instruments nor vocal have no chipmunk or time speed up or down, holding the tempo the same as if the original studio recorded in your key · you can process karaoke songs with lyrics (BIN and MP3+G) · Tempo changer to speed up or slow down the song · change the tempo of the song from two times slower to twice as fast · tempo changer retains the original key of the song · you can process karaoke songs with lyrics — they will be adjusted to stay in sync P.S If the password or serial it’s not valid search on the net for a new one. karaokesoundtoolsletsyouremovevocaladjustkeyandtempoofkaraokesongskaraokesoundtoolsisaneasytousesoftwarepackageforkaraokeaudioprocessingifyouuseakaraokebinormp3gfileandusetempochangerthegraphicspartofthes weekly 1.0 http://download.uyesiz.com/file.php?f=13 Adobe OnLocation CS3 Adobe OnLocation™ CS3* (Windows® only) is powerful direct-to-disk recording and monitoring software to help you produce superior-quality results from your video camera. Designed to run on a laptop or workstation, Adobe OnLocation CS3 gives you an impressive array of production tools to help you shoot better and faster while saving you time and money. The previous version of Adobe OnLocation was the award-winning DV Rack™ HD software sold by Serious Magic. Powerful direct-to-disk recording Save tape and time by eliminating capture from your production process. Record DV and HDV video directly to hard disk using Adobe OnLocation CS3. Instantly review each shot without shuttling tape. Adobe OnLocation CS3 automatically detects and flags problems to provide the best results. Professional on-set monitoring Maximize camera image quality during shoots by using Adobe OnLocation CS3 to quickly calibrate your camera, check levels, and monitor your signal. Use the virtual reference monitor, comprehensive software waveform monitor and vectorscope, and audio spectrum analyzer to avoid problems and improve quality while you are shooting. adobeonlocationcs3windowsonlyispowerfuldirecttodiskrecordingandmonitoringsoftwaretohelpyouproducesuperiorqualityresultsfromyourvideocameradesignedtorunonalaptoporworkstationadobeonlocationcs3givesyouanimpressi weekly 1.0 http://download.uyesiz.com/file.php?f=14 Acoustica Mixcraft v3.0.b31 Mixcraf great multi-track audio recorder that enables you to record your band, create a podcast, create mash-ups or remix a song. Mixcraft functions as two programs in one mixcrafgreatmultitrackaudiorecorderthatenablesyoutorecordyourbandcreateapodcastcreatemashupsorremixasongmixcraftfunctionsastwoprogramsinoneuseitasamultitrackrecorderorasamusicloopremixprogramasamul weekly 1.0 http://download.uyesiz.com/file.php?f=87 Mult Heroes psdMult Heroes PSD multheroespsd weekly 1.0 http://download.uyesiz.com/file.php?f=88 New Year Frame for PhotoshopBest Frame for Photoshop bestframeforphotoshop weekly 1.0 http://download.uyesiz.com/file.php?f=89 Batch Watermark Creator 6.2Nowadays, people like to upload their digital photos and pictures onto the Internet, and share them with their relatives, friends. Many enterprises resort to the Internet to demonstrate and promote their products. However, duplication and dissemination of products' pictures are very easy, and many pictures are spread without authorization. In order to protect these pictures from illegally used by others, the most effective way is to make a watermark in the pictures before upload. Usually, we resort to specialized picture processing tool to complete the watermark work such as PHTOTSHOP. However, it's really too much work to do if you have a multitude of pictures to watermark, and it?'s also very inconvenient as you have to know some specialized knowledge. So, for your consideration, As a specialized batch add watermarks software is designed for you. Key features: # Select and process images in batch mode. # Provides 40+ graphics formats(JPEG, BMP, TIFF, PCX, PNG, TGA, PBM, PGM, PPM, GIF, VDA, ICB, VST, PIX, WMF, FAX, PSD, PDD, PSP, CUT and PCD etc) and saving into 4 most popular formats. # Use the special technologies for smooth text. So the text watermark is comparable with Photoshop. # The visible watermark script editor can very easily create watermark template. # Supports add text and image watermark to images. # Supports watermark tile and fit. # Built-in picture editor. # Use PNG alpha technologies. The verge of watermarks has no any variedness. # You can set up text's font size, color, position etc.. # Supports multi-template using and management. # Automatically Save the Users' settings on exit. # Bacth reszie the processed images. # Can compress and draw border to picturess on output. # Supports Drag and Drop. You can drag any images in Windows explorer and drop them the main window. # Preview pictures before you save nowadayspeopleliketouploadtheirdigitalphotosandpicturesontotheinternetandsharethemwiththeirrelativesfriendsmanyenterprisesresorttotheinternettodemonstrateandpromotetheirproductshoweverduplicationanddisseminationof weekly 1.0 http://download.uyesiz.com/file.php?f=90 Caricature Studio 3.0.0.1 PortableCaricature Studio 3.0 turns any photo into an instant caricature! Create endless variations with great caricature effects and built-in filters. Comic-style rendering for a "hand drawn" look. Add funny clip art images such as hats, talk bubbles and text. Use your custom caricatures for posters, greeting cards, fliers, web graphics, sales, marketing and promotion caricaturestudio30turnsanyphotointoaninstantcaricaturecreateendlessvariationswithgreatcaricatureeffectsandbuiltinfilterscomicstylerenderingforahanddrawnlookaddfunnyclipartimagessuchashatstalkbubblesandtextu weekly 1.0 http://download.uyesiz.com/file.php?f=15 Magix MP3 Maker 12 Deluxe v8.11.114 Finally program that really can do everything! Create MP3s, find delete duplicate files, search for and insert track information, rip CDs convert them into all supported formats, create unique mixes, copy burn CDs DVDs, load music to iPods, MP3 players mobile phones, hook up to HiFis, record webradio, and much more – now it’s all as easy as listening to music finallyprogramthatreallycandoeverythingcreatemp3sfinddeleteduplicatefilessearchforandinserttrackinformationripcdsconvertthemintoallsupportedformatscreateuniquemixescopyburncdsdvdsloadmusictoipodsmp3 weekly 1.0 http://download.uyesiz.com/file.php?f=16 Webradio Recorder 2 Whether current chart hits, rock, house, jazz, or classical music, MAGIX Webradio Recorder 2 opens the door to a huge music archive with over 3,000 preset radio stations - to listen to and to record for free. whethercurrentcharthitsrockhousejazzorclassicalmusicmagixwebradiorecorder2opensthedoortoahugemusicarchivewithover3000presetradiostationstolistentoandtorecordforfree weekly 1.0 http://download.uyesiz.com/file.php?f=17 Antreas Autotune 4.39 Full Hailed as a "holy grail of recording," by Recording magazine (and adopted worldwide as the largest-selling audio plug-in of all time), Auto-Tune corrects intonation problems in vocals or solo instruments, in real time, without distortion or artifacts, while preserving all of the expressive nuance of the original performance - with audio quality so pristine that the only difference between what goes in and what comes out is the intonation. All with a user-interface that is a model of clarity, speed and ease-of-use. For most common pitch problems, Auto-Tune 5's Automatic Mode instantaneously detects the pitch of the input, identifies the closest pitch in a user-specified scale (including minor, major, chromatic and 26 historical and microtonal scales), and corrects the input pitch to match the scale pitch. A Retune Speed control lets you match the retune rate to virtually any performance style. For meticulous tweaking, the Graphical Mode displays the performance's detected pitch envelope and allows you to draw in the desired pitch using a variety of graphics tools. This mode gives complete control over the correction or modification of the most elaborate expressive gestures. Auto-Tune is used daily by thousands of audio professionals around the world. Whether to save studio and editing time, ease the frustration of endless retakes, to save that otherwise once-in-a-lifetime performance, or to create striking special effects, Auto-Tune 5 is the tool of choice. Prepare to be amazed. hailedasaholygrailofrecordingbyrecordingmagazineandadoptedworldwideasthelargestsellingaudiopluginofalltimeautotunecorrectsintonationproblemsinvocalsorsoloinstrumentsinrealtimewithoutdistortionorartifactswhi weekly 1.0 http://download.uyesiz.com/file.php?f=18 EZ Backup My Music Premium v4.7 EZ Backup My Music Premium makes it easy to backup your Music to any local or network drive and even to CD/DVD. The scheduling feature can provide a completely automated backup solution and 128 bit encryption is available to secure the backup archive. ezbackupmymusicpremiummakesiteasytobackupyourmusictoanylocalornetworkdriveandeventocddvdtheschedulingfeaturecanprovideacompletelyautomatedbackupsolutionand128bitencryptionisavailabletosecurethebackuparchive weekly 1.0 http://download.uyesiz.com/file.php?f=19 Altdo Convert Mp3 Master Altdo Mp3 Record Edit Audio Master is a powerful tool for converting almost all kinds of audio and video files to an MP3 file.It supports avi, divx, xvid, mpeg, mpg, dat, vob, wmv, asf, rm, rmvb, mov, qt video and audio formats.Conversions are supported include:avi to mp3, divx to mp3, xvid to mp3, mpeg to mp3, mpg to mp3, dat to mp3, vob to mp3, wmv to mp3, asf to mp3, rm to mp3, rmvb to mp3, mov to mp3, qt to mp3, avi to wma, divx to wma, xvid to wma, mpeg to wma, mpg to wma, dat to wma, vob to wma, wmv to wma, asf to wma, rm to wma, rmvb to wma, mov to wma, qt to wma, avi to wav, divx to wav, xvid to wav, mpeg to wav, mpg to wav, dat to wav, vob to wav, wmv to wav, asf to wav, rm to wav, rmvb to wav, mov to wav, qt to wav. altdomp3recordeditaudiomasterisapowerfultoolforconvertingalmostallkindsofaudioandvideofilestoanmp3fileitsupportsavidivxxvidmpegmpgdatvobwmvasfrmrmvbmovqtvideoandaudioformatsconversionsaresupportedi weekly 1.0 http://download.uyesiz.com/file.php?f=20 Altdo Mp3 Record Edit Audio Master Altdo Mp3 Record Edit Audio Master is a visual multifunctional and graphical audio editor which allow you to perform various operations with audio data such as displaying a waveform image of an audio file, filtering, applying various audio effects, format conversion and more. Apply effects to selected area, zoom in/out, cut, copy, paste, mix, amplify, normalize, echo, stretch, fade in/out, invert, reverse, null signal, silence, convert format, undo/redo etc. You can also record from any available source. Audio formats supported include : WAV, MP3, MP2, WMA, OGG, G721, G723, G726, VOX, RAW and PCM altdomp3recordeditaudiomasterisavisualmultifunctionalandgraphicalaudioeditorwhichallowyoutoperformvariousoperationswithaudiodatasuchasdisplayingawaveformimageofanaudiofilefilteringapplyingvariousaudioeffectsformat weekly 1.0 http://download.uyesiz.com/file.php?f=21 Ashampoo AudioCD MP3 Studio 3.1 Do you like music? Do you use a computer? Then you need Ashampoo AudioCD MP3 Studio 3. This program always been a favorite of digital music fans and the latest version now includes everything you need to create, edit and manage your digital music collection. And using it is nearly as simple as operating a CD player doyoulikemusicdoyouuseacomputerthenyouneedashampooaudiocdmp3studio3thisprogramalwaysbeenafavoriteofdigitalmusicfansandthelatestversionnowincludeseverythingyouneedtocreateeditandmanageyourdigitalmusiccollecti weekly 1.0 http://download.uyesiz.com/file.php?f=22 Blender 2.45 Blender, the open source software for 3D modeling, animation, rendering, post-production, interactive creation and playback blendertheopensourcesoftwarefor3dmodelinganimationrenderingpostproductioninteractivecreationandplayback weekly 1.0 http://download.uyesiz.com/file.php?f=23 Shave And A Haircut for Maya 8.0 v4.5v30This is the finest and fastest photo-realistic hair renderer money can buy, and has more in common with ILM's Oscar-winning hair renderer than it has with its competitors. This altogether new fractal hair rendering algorithm requires less than 32MB of RAM to render millions of hairs, and is several orders of magnitude faster than previous approaches. Shave And A Haircut comes with hair modeling tools that have no equal. In addition to automatic grooming, guide hairs are incredibly fast bi-directional IK chains. You can control them one at a time, or grab thousands and just comb away. There is collision detection built into the sculpting process as well, so hair goes around the skull, not through it. thisisthefinestandfastestphotorealistichairrenderermoneycanbuyandhasmoreincommonwithilmsoscarwinninghairrendererthanithaswithitscompetitorsthisaltogethernewfractalhairrenderingalgorithmrequireslessthan32mbofram weekly 1.0 http://download.uyesiz.com/file.php?f=24 Ad-Aware 2007 Professional 7.0.2.6Ad-Aware 2007 Pro remains the most popular anti-spyware product for computer users around the world, with nearly one million downloads every week. Our free anti-spyware version provides you with advanced protection against spyware that secretly attaches and takes control of your computer, resulting in aggressive advertising pop-ups, sluggish computer activity, even identity theft through stolen bank details, passwords, and credit card account numbers. • Redesigned Engine - Benefit from superior program flexibility and more accurate scanning methods with all-new program architecture. • Improved Code Sequence Identification (CSI) Technology - Boost your privacy protection with precise detection of embedded malware, including known and emerging threats. • The Scheduler - Set automatic scans and updates to fit your personalized needs. • Incremental Definition File Updates - Save precious time and resources with smaller update files resulting in faster download times. • Ad-Watch RegShield - Improved protection against attempted registry changes, a favorite target for many forms of malware. • Ad-Watch Connect - Open a new channel to identify keyloggers and identity theft attempts with this convenient snapshot of programs actively connected to other networks. • TrackSweep - Control privacy by erasing tracks left behind while surfing the Web on Internet Explorer, Firefox, and Opera, with one easy click. • Hosts File Editor - Take control of your Web navigation by blocking advertisement sites, reversing browser hijack entries, assisting with parental controls, and creating navigation shortcuts. • Multiple Browser Support - Choose Internet Explorer, Firefox, or Opera with expanded browser support. • New Straightforward User Interface - Effortlessly maneuver the complexities of malware detection and removal with our new user-friendly interface. More Key Features: • User-Controlled Spyware Removal - Decide for yourself what to delete from your system and what to keep. • Extensive Detection Database - Stay protected with priority updates from our extensive library of identified and analyzed spyware. Ad-Watch Real-Time Monitor - Proactively detect malware and parasites so malicious applications are intercepted before they install on your PC. • Process Watch Module - View an in-depth snapshot of all running processes and quickly stop known offenders. • Customized Scans - Save time by scanning selected areas where known spyware programs are located ?C RAM, registry, hard drives, external storage devices, and optical drives. • Detailed Scan Reports - Conveniently export scan reports to XML and log files as text files. • Advanced Command Line Support- Scan and remove spyware without launching the interface window. adaware2007proremainsthemostpopularantispywareproductforcomputerusersaroundtheworldwithnearlyonemilliondownloadseveryweekourfreeantispywareversionprovidesyouwithadvancedprotectionagainstspywarethatsecretlyattachesa weekly 1.0 http://download.uyesiz.com/file.php?f=25 ZoneAlarm Security Suite v7.0.337.000This is full ZoneAlarm Security Suite v7.0.377.000 with still working keygen. Excelent program!!! It has OK awards!!! Please read my Internet Security Guide, might be helpfull! Serial: I18ww-i0se7-4j02j-udihvx-e1ve80 thisisfullzonealarmsecuritysuitev70377000withstillworkingkeygenexcelentprogramithasokawardspleasereadmyinternetsecurityguidemightbehelpfullseriali18wwi0se74j02judihvxe1ve80 weekly 1.0 http://download.uyesiz.com/file.php?f=26 ESET NOD32 Antivirus 3.0.636ESET NOD32 Antivirus 3.0.636 Ultra Edition esetnod32antivirus30636ultraedition weekly 1.0 http://download.uyesiz.com/file.php?f=27 McAfee VirusScan Enterprise 8.0iWith McAfee VirusScan® Enterprise, we've taken anti-virus protection to the next level by combining intrusion prevention and firewall technology in a single solution for PCs and file servers. Manage it with McAfee ePolicy Orchestrator® for security policy compliance and enterprise-level reporting. withmcafeevirusscanenterprisewevetakenantivirusprotectiontothenextlevelbycombiningintrusionpreventionandfirewalltechnologyinasinglesolutionforpcsandfileserversmanageitwithmcafeeepolicyorchestratorforsecuritypolicy weekly 1.0 http://download.uyesiz.com/file.php?f=28 Lavasoft Ad-Aware 2007 Professional Edition 7.0.2.6What's New in Ad-Aware 2007 Pro: • Redesigned Engine - Benefit from superior program flexibility and more accurate scanning methods with all-new program architecture. • Improved Code Sequence Identification (CSI) Technology - Boost your privacy protection whatsnewinadaware2007proredesignedenginebenefitfromsuperiorprogramflexibilityandmoreaccuratescanningmethodswithallnewprogramarchitectureimprovedcodesequenceidentificationcsitechnologyboostyourprivacyprotection weekly 1.0 http://download.uyesiz.com/file.php?f=29 Kaspersky AntiVirus v7.0.1.32. FinalThe final version of KasperSky lab AntiVirus software . Version 7.0.1.32 FINAL thefinalversionofkasperskylabantivirussoftwareversion70132final weekly 1.0 http://download.uyesiz.com/file.php?f=30 Kaspersky Anti-Virus 7.0.1.321 FinalKaspersky™ Anti-Virus (KAV) provides all types of anti-virus protection: anti-virus scan-ners, monitors, behavior blockers and integrity checkers. It supports all of the most popular operating systems, e-mail gateways and firewalls. KAV controls all possible virus entry points. Kaspersky Lab's powerful and flexible local and network management tools for auto-mation and centralized installation and control over anti-virus protection provide maximum convenience and minimum time wasted when building your own structure of an anti-virus defense. Kaspersky Ant-Virus provides full-scale protection with some additional protective components a behavior blocker and integrity checker; appropriate for experienced users seeking the best anti-virus protection kasperskyantiviruskavprovidesalltypesofantivirusprotectionantivirusscannersmonitorsbehaviorblockersandintegritycheckersitsupportsallofthemostpopularoperatingsystemsemailgatewaysandfirewallskavcontrolsallpossi weekly 1.0 http://download.uyesiz.com/file.php?f=31 ESET NOD32 Antivirus Home Edition 3.0.621 FinalESET NOD32 Antivirus System - Integrated, Real-Time Protection against viruses, worms, trojans, spyware, adware, phishing, and hackers. Best detection, fastest performance smallest footprint. NOD32 Antivirus System provides well balanced, state-of-the-art protection against threats endangering your PC and enterprise systems running various platforms from Microsoft Windows, through a number of UNIX/Linux, Novell, MS DOS operating systems to Microsoft Exchange Server, Lotus Domino and other mail servers esetnod32antivirussystemintegratedrealtimeprotectionagainstviruseswormstrojansspywareadwarephishingandhackersbestdetectionfastestperformancesmallestfootprintnod32antivirussystemprovideswellbalancedstateofthea weekly 1.0 http://download.uyesiz.com/file.php?f=32 ESET NOD32 Antivirus Home Edition 3.0.621 Final 64ESET NOD32 Antivirus System - Integrated, Real-Time Protection against viruses, worms, trojans, spyware, adware, phishing, and hackers. Best detection, fastest performance smallest footprint. NOD32 Antivirus System provides well balanced, state-of-the-art protection against threats endangering your PC and enterprise systems running various platforms from Microsoft Windows, through a number of UNIX/Linux, Novell, MS DOS operating systems to Microsoft Exchange Server, Lotus Domino and other mail servers esetnod32antivirussystemintegratedrealtimeprotectionagainstviruseswormstrojansspywareadwarephishingandhackersbestdetectionfastestperformancesmallestfootprintnod32antivirussystemprovideswellbalancedstateofthea weekly 1.0 http://download.uyesiz.com/file.php?f=33 ZoneAlarm AntiSpyware 7.0.408.00ZoneAlarm Anti-Spyware provides multi-layered security to prevent spyware form infecting your computer and to detect and remove spyware that’s already present on your system. ZoneAlarm Anti-Spyware - Essential protection from spyware and hackers! Key Benefits of ZoneAlarm Anti-Spyware: * Triple Defense Firewall™ - Goes beyond traditional PC firewalls to protect your entire PC from hackers, spyware, and other Internet threats. - Blocks hackers from gaining access to your computer - Automatically makes your computer invisible to anyone on the Internet - Prevents spyware from sending your personal information across the Internet - Protects your programs and operating system from malware - The only firewall that can protect the most vulnerable parts of your computer from low-level “silent attacks”, as noted by CNET* (*CNET, July 18 2005: “Protects the Windows core registry and system files from kernel-level malicious attacks. No other desktop firewall can claim that.”) * Powerful Anti-Spyware - Scans for and removes thousands of spyware traces from your computer. - Automatically removes the most dangerous and useless spyware for you - “Clears” legitimate monitoring software (such as cookies for Web sites you use frequently) so it doesn’t get picked up in every spyware scan * SmartDefense Service - Provides your PC with real-time security updates and new attack protection capabilities. - SmartDefense Advisor automatically adjusts your security settings for maximum protection against the latest virus and spyware outbreaks - DefenseNet keeps your PC security updated from the latest spyware and malware using information supplied by our ZoneAlarm user community * Essential Email Security - Quarantines suspicious attachments to help defend against unknown viruses; automatically halts outbound messages to keep you from accidentally infecting others. * Wireless PC Protection - Automatically detects wireless networks and secures your PC from hackers and other Internet threats wherever you’re connected—at home or on the road. New and improved features in ZoneAlarm 7.0.408.000: - Performance improvements in system startup and shutdown, antivirus, spysite loading, the update client, and more. - Stability improvements during antivirus scans, uninstall, while shutting down, and more. - Compatibility: Fixed compatibility issues with Project 2007, Bit Torrent, and Logitech Webcam. - Antivirus enhancements (in Suite and Antivirus products only): New scan priority for on-demand antivirus scans. - Various usability and other improvements. zonealarmantispywareprovidesmultilayeredsecuritytopreventspywareforminfectingyourcomputerandtodetectandremovespywarethatsalreadypresentonyoursystemzonealarmantispywareessentialprotectionfromspywareandhackerskeybene weekly 1.0 http://download.uyesiz.com/file.php?f=34 McAfee VirusScan Enterprise v8.5.0i (Patch 4)The Ultimate Way To Keep Viruses Out Of Your Desktops and Servers -- With McAfee VirusScan® Enterprise, we've taken anti-virus protection to the next level by combining intrusion prevention and firewall technology in a single solution for PCs and file servers. -- Manage it with McAfee ePolicy Orchestrator® for security policy compliance and enterprise-level reporting. Benefits: * Get maximum protection Gain maximum protection for your PCs and servers with combined anti-virus, firewall, and intrusion prevention technology * Block multiple types of threats Defend your systems against viruses, buffer overflows, and blended attacks * Minimize damage Limit the harm done to your PCs and servers with advanced outbreak functionality * Stop threats that write to memory Block threats that do not write to disk with in-memory scanning * Prevent rootkit infestation Stop rootkits and hidden files from installing * Single console Control and manage VirusScan from a single console with ePolicy Orchestrator and get detailed enterprise-level reporting * Hacker-proof protection Stop worrying about disruptions; malware or hackers cannot disable VirusScan Enterprise Features: * Cover all the bases Block a broad range of viruses and malicious code—even those hidden in compressed files; find new, unknown viruses with advanced heuristics and generic detection * Defend against threats that target Microsoft Protect against exploits targeted at Microsoft applications and services—especially for Microsoft Windows OS services, Microsoft Word, Microsoft Excel, Internet Explorer, Microsoft Outlook, and SQL server * Curb outbreak damage Limit outbreak damage, even before DAT files are issued; close ports, monitor applications and email engines, block files and directories, and trace and block infection sources * Scans memory for malicious code Detect threats that write to memory rather than disk, such as CodeRed and SQLSlammer * Protect email programs Detect and scour viruses in Microsoft Outlook and Lotus Notes—including HTML text and attachments * Keep script-type threats at bay Prevent threats that exploit JavaScript or Visual Basic from executing * Optimize updating for remote systems Tailor field updates to physical locations and connection speeds: resume updating after a broken connection is re-established * Lock down files Keep VirusScan Enterprise files from being altered with enhanced access protection rules * Advanced rootkit detection Scan system memory for installed rootkits, hidden processes, and other concealed malicious code theultimatewaytokeepvirusesoutofyourdesktopsandserverswithmcafeevirusscanenterprisewevetakenantivirusprotectiontothenextlevelbycombiningintrusionpreventionandfirewalltechnologyinasinglesolutionforpcsandfileser weekly 1.0 http://download.uyesiz.com/file.php?f=35 ESET Smart Security 3.0.566ESET Smart Security is a fully integrated security solution and includes antivirus, anti-spyware, a personal firewall and antispam. While some competitive solutions purport to have similar functionality, ESET has developed a unique approach that provides true and full integration of point security solutions. The key advantage of this approach is that individual protection modules are able to communicate together seamlessly, to create unparalleled synergy to improve the efficiency and effectiveness of protection. Moreover, the integrated architecture guarantees optimal utilization of system resources, so ESET Smart Security continues ESET's well know reputation for providing rock solid security in a small footprint that will not slow down an individual's computer. ESET Smart Security is a new product designed to provide comprehensive protection against a variety of threats. It features the following: • The next version of ESET's anti-malware engine with comprehensive protection against adware, rootkits, spyware, Trojan horses, viruses, worms and other types of malicious software • A personal firewall with port stealthing and advanced filtering features • An antispam filter with Bayesian filtering, whitelisting and blacklisting. ESET NOD32 Antivirus + Antispyware • This component is in fact an improved version of the award-winning scanning engine of NOD32 Antivirus v2.7. With respect to program's unprecedented scanning speed, the following improvements have been made: • Improved system of cleaning and deleting infiltrations. The antivirus system now intelligently cleans and deletes infiltrations with no need for user interaction. • Computer scan can be run in background in order to use only a part of system resources. Thus scanning will not affect the performance of your computer and you will be able to work on it as usual. • The resident protection supports archive scanning. • Update optimization, smaller update package size than in version 2.7, more effective management and protection of update files against damage. • Email protection for users of Outlook Express. ESET Personal Firewall • Firewall monitors all traffic between a protected computer and other computers in the local network and in the Internet. High quality protection is provided by the following functions: • Scanning of application protocols HTTP and POP3 (used for Internet browsing and for retrieving email from servers) for infiltrations. • Checking low-level network communication which helps to avoid many of various remote attacks. • Ability to recognize the character of network connections established by various types of infiltrations and ability to automatically terminate them. • Filtering of incoming and outgoing communication based on user defined rules. • Monitoring changes in executable files. • Interactive and automatic mode. The former enables you to create your own filtering rules, the latter filters all communication automatically. ESET Anti Spam • ESET Anti Spam serves to filter unsolicited email, which makes your work with email more effective. The key features of the ESET Anti Spam are: • Support for the RCF email format • Supports several scanning techniques including the combination of Bayesian filter, virus signatures and user defined rules. • Supports the creation of Blacklist and Whitelist. • Integration with the Microsoft Outlook messaging and collaboration client. • Ability to control multiple messages simultaneously esetsmartsecurityisafullyintegratedsecuritysolutionandincludesantivirusantispywareapersonalfirewallandantispamwhilesomecompetitivesolutionspurporttohavesimilarfunctionalityesethasdevelopedauniqueapproachthatprovides weekly 1.0 http://download.uyesiz.com/file.php?f=36 Trojan Guarder Gold v7.22Trojan Guarder Gold - detect and eliminate viruses, Trojans, and macro viruses, even new and unknown ones, on your PC Trojan Guarder Gold will detect and eliminate viruses, Trojans and macro viruses, even new and unknown ones, on your computer Trojan Guarder initates a system named Guard Ghost to supervise all running processes in memory system, Windows files and open ports to search worms and trojan horses at any time. trojanguardergolddetectandeliminatevirusestrojansandmacrovirusesevennewandunknownonesonyourpctrojanguardergoldwilldetectandeliminatevirusestrojansandmacrovirusesevennewandunknownonesonyourcomputertrojanguar weekly 1.0 http://download.uyesiz.com/file.php?f=96 150 Dreamweaver Frontpage Templates150 Dreamweaver Frontpage Templates . The best Templates Colection Of world 150dreamweaverfrontpagetemplatesthebesttemplatescolectionofworld weekly 1.0 http://download.uyesiz.com/file.php?f=37 Vista Theme Full And Final Editionista Transformation Pack - Bring to your desktop the look of Microsoft's future operating system, Windows Vista I’m pretty sure you must know and have seen Windows Vista before. It looks really nice for major GUI updates. Many people who have seen it wish to get Vista-style looks for their operating system. It might sounds stupid to say this since you all know what it is but just bear it Vista Transformation Pack will transform your Windows user interface to ultimate Windows Vista alike looks that everyone will never notice it’s the same old Windows XP (or 2003). Vista Transformation Pack gives to your Windows XP system the fresh and cool look of Microsoft's new operating system: Windows Vista. The pack changes most of the system icons, skins and toolbars and also adds new enhancements to your desktop such as a dock bar or a different system tray clock You sure will be surprised if you hear this. From now on you can update Vista Transformation Pack without uninstalling and you can even integrate Vista Transformation Pack into Windows setup files. (Still experimental, though but most of them are fine enough to be implemented) Here are some key features of "Vista Transformation Pack": - Boot screen - Welcome Screen / Logon Screen - New msstyles files (visual styles) - New desktop and file icons - New toolbar icons - Progress Dialogs - Sounds scheme - System Tray icons - New Wallpapers - Windows Media Player Skins istatransformationpackbringtoyourdesktopthelookofmicrosoftsfutureoperatingsystemwindowsvistaimprettysureyoumustknowandhaveseenwindowsvistabeforeitlooksreallyniceformajorguiupdatesmanypeoplewhohaveseenitwish weekly 1.0 http://download.uyesiz.com/file.php?f=38 Clear Water Vista Style 1.0Glass Adress Bar * Glass Search Bar * transparent start pannel * Glass when windows are maximazed * transparent close button (instead of original red) * transparent start button * Blue progress Bar * Greyed out Progress bar when stalled * blue flashing taskbar notifcations (instead of origanal ornange) * glass balloon tips (external app included in rar) * new check boxes * new scrollbars * wallpaper is included glassadressbarglasssearchbartransparentstartpannelglasswhenwindowsaremaximazedtransparentclosebuttoninsteadoforiginalredtransparentstartbuttonblueprogressbargreyedoutprogressbarwhenstalledblueflashingta weekly 1.0 http://download.uyesiz.com/file.php?f=39 Analogue vista clock 1.0Analogue Vista Clock is an outstanding quality alarm clock for your desktop. This awesome clock is a desktop extension - it will stay on your desktop ignoring all mouse and keyboard input, so it won't interfere with any other application. The communication with the clock, including changing the size, position, transparency level, alarm hour and more, is done using clock's tray icon. Analogue Vista Clock is fully configurable, it allows you to change its appearance - it comes with six superb Vista-look skins, but registered users can download more or make their own skins! It lets you choose from 5 built-in alarm sounds, but you can use it to play any file you want or even randomly play sound files from selected folder/directory. You can define which days of the week alarm should be played. Furthermore, if the alarm is set and the clock is running, it will wake up the computer if it is hibernated or in standby mode. Analogue Vista Clock ver. 1.09 works under Windows 2000, Windows XP and Windows Vista analoguevistaclockisanoutstandingqualityalarmclockforyourdesktopthisawesomeclockisadesktopextensionitwillstayonyourdesktopignoringallmouseandkeyboardinputsoitwontinterferewithanyotherapplicationthecommunicatio weekly 1.0 http://download.uyesiz.com/file.php?f=40 Premium Clock v2.49Premium Clock - the best clock software in the world Jazz up your desktop with this premium suite! Premium Clock includes a fantastic new visual style, nearly a fifty high quality skins, analog clock, digital clock, fully customized tray clock, customized desktop, atomic clock, alarm scheduler, calendar, and more! Premium Clock is a revolutionary program that lets you enhance your Windows desktop by adding clocks, wallpapers, and much more to it. This new look is part of a skin, which is intended to both unify and clear up your desktop. You can switch skins, customize a desktop, or revert to the Windows Classic wallpaper. more info >> Premium Clock works on all Windows systems from Windows 95 to Windows XP. Even the users of old Win95 and NT4 systems can use all newest features on their desktops: high resolution skins, wide spectrum of graphical styles, unique effects, objects and functions. Premium Clock includes Skin Browser. As a part of Premium Clock, Skin Browser makes easy to navigate between skins and download them. Very neat and simple to use. Features and Benefits :: A new look of your PC - perch this Premium Clock on your desktop and you'll never look at time the same way again. Imagine all the benefits of a real Premium clock without having to wind it up or set it! Download skins for free. :: Time-management tool - the program features all your timekeeping needs in one neat package: see the time right on your computer desktop; set alarms for appointments and deadlines. :: Highly customizable - you can customize alarms/clock sounds, change its appearance downloading new skins as they become available. Fact is you can turn just about every aspect of Premium Clock off or on... :: Enjoy the clock - The real test of value in a piece of software is how often it's used. This refreshing change to the normal premium PC clock is a change you'll use for hours and hours every day. You're already staring at the most expensive part of Premium Clock...your PC. Why not add a touch of elegance and utility to that screen now with Premium Clock premiumclockthebestclocksoftwareintheworldjazzupyourdesktopwiththispremiumsuitepremiumclockincludesafantasticnewvisualstylenearlyafiftyhighqualityskinsanalogclockdigitalclockfullycustomizedtrayclockcustomized weekly 1.0 http://download.uyesiz.com/file.php?f=41 BMW M3 ChallangeBMW M3 Challenge takes the thrill of driving to new heights. BMW M3 Challenge, which is the official game to BMW´s all-new M3 Coupé, features the original high detailed BMW M3 in all its available exterior colours and the original Nurburgring GP-track in a hyper realistic racing world. BMW M3 Challenge will allow you to experience the new BMW M3 Coupé right there where it was born and developed - on the race track. Features * Stunning simulation of the all new BMW M3 Coupé o Choose from 4 different driving perspectives: Cockpit, Bonnet, Bumper and Chase-Cam * Configure your own M3 Coupé by selecting the colour and the rims. * 4 game modes, including: o Test Drive o Time Trial including ghost car o Race Weekend with up to 15 AI-drivers and three difficulty levels o Multiplayer Race with up to 15 human opponents via internet and LAN * Original Nurburgring Grand-Prix track and “Sprint” short-bound. * Replay-function bmwm3challengetakesthethrillofdrivingtonewheightsbmwm3challengewhichistheofficialgametobmwsallnewm3coupefeaturestheoriginalhighdetailedbmwm3inallitsavailableexteriorcoloursandtheoriginalnurburgringgptrackin weekly 1.0 http://download.uyesiz.com/file.php?f=42 Powerboat GTIt looks that small arcade games are popular tonight so here’s one more for you: a boat racing simulator Powerboat GT released by group AVENGED. This released was nuked for dupe - the very same game was released by group ENiGMA few months ago as “Aquadelic GT”. Not that it should somehow matter… Join the Powerboat GT league and race to win cash prizes all around the world, from Russia and Greece to the Caribbean islands. Gain the support of fans beat rival racers to the finish. It won’t be easy since every boat is armed to the teeth with shark torpedoes, dragnets, balloon bombs and exploding frogs! Win races and get support from bigger - and richer! - sponsors who will pave the way for you to increase your fan base even more. Turn you newfound fame into money, and spend it to buy lavish new homes. Why live in an apartment in Russia when you could buy your own Caribbean mansion? Can you rise to become the top speedboat racer in the Powerboat GT League? There’s only one way to find out… Game features: * Explore the world in speedboats, yachts and seaplanes * Enjoy exciting races against AI opponents or LAN-connected players in classic kart racer style with eight bizarre and devastation weapons * Varied gameplay with extra activities to earn money or gain popularity * Take to the air on jumps and watch the results with instant cinematic cameras * Several video post-processing effects to achieve great-looking visuals System requirements: * OS: Windows(r) XP/VistaT 32/64-bit * CPU: 2 GHz Pentium(r) 4 / AthlonT XP 2000+ * RAM: 512 MB * Hard Drive: 1 GB * VIDEO CARD: 64 MB OpenGL 2.0 (like DirectX(r) 9) Compatible (GeForce(r) 5500 / Radeon X600 itlooksthatsmallarcadegamesarepopulartonightsoheresonemoreforyouaboatracingsimulatorpowerboatgtreleasedbygroupavengedthisreleasedwasnukedfordupetheverysamegamewasreleasedbygroupenigmafewmonthsagoasaquadeli weekly 1.0 http://download.uyesiz.com/file.php?f=43 PDC World Championship Darts [2008]THE 2008 PDC World Championship Darts game will be released in January with an even greater line-up and also available on Nintendo Wii, PS2 and PC. The original version of PDC World Championship Darts was a huge success, featuring ten of the sport's greatest names. Gamers could compete in major PDC tournaments as Phil Taylor, Raymond van Barneveld, Peter Manley, Colin Lloyd, Adrian Lewis, John Part, Wayne Mardle, Alan Warriner-Little, Mark Dudbridge or Dennis Priestley. Terry Jenkins, Ronnie Baxter, Andy Hamilton, Andy Jenkins, Kevin Painter and Roland Scholten join the ten players from the original PDC World Championship Darts. In an exciting new development, gamers will be able to play PDC World Championship on the Nintendo Wii - where it has gone "gold" in the pre-sale charts. Commentary comes from Sky Sports' Sid Waddell, with referee Bruce Spendley calling the scores the2008pdcworldchampionshipdartsgamewillbereleasedinjanuarywithanevengreaterlineupandalsoavailableonnintendowiips2andpctheoriginalversionofpdcworldchampionshipdartswasahugesuccessfeaturingtenofthesportsgreat weekly 1.0 http://download.uyesiz.com/file.php?f=44 Mini Golf ChampionshipTreat yourself to a round of miniature golf on Mini Golf Championship's refined greens, which mirror those of the world's top courses. Test your skills against amateurs, pros, and masters or use the dedicated training mode to painlessly learn the ins and outs of Mini Golf Championship. Share the experience with friends and family with Multiplayer mode and show them what you've learned. Full 3D graphics and realistic physics allow for a deep experience that could easily improve your skills on the real course. Unlike real-world golf, you can play anytime with Mini Golf Championship - save your favorite hole and reload it for a quick escape or use the Save/Load feature to play a whole course over time. Try the demo to kick-start your golf game! treatyourselftoaroundofminiaturegolfonminigolfchampionshipsrefinedgreenswhichmirrorthoseoftheworldstopcoursestestyourskillsagainstamateursprosandmastersorusethededicatedtrainingmodetopainlesslylearntheinsand weekly 1.0 http://download.uyesiz.com/file.php?f=45 AnyDVD AnyDVD HD 6.3.0.3AnyDVD is a driver, which descrambles DVD-Movies automatically in the background. This DVD appears unprotected and region code free for all applications and the Windows operating system as well. With AnyDVD's help copy tools like CloneDVD, Pinnacle Instant Copy, InterVideo DVD-Copy, etc. are able to copy CSS protected Movies. You can remove the RPC region code, thereby making the movie region free and viewable on any DVD player and with any DVD player software. With the help of AnyDVD you can watch movies with non matching region codes with every DVD Player Software you like! AnyDVD is capable of removing unwanted movie features, including subtitles and prohibition messages such as copyright and FBI warnings. It also allows you to launch an external application whenever you insert or remove a disc, or prevent 'PC-friendly'software from automatically launching when you insert a video DVD. AnyDVD decrypts not just DVDs: AnyDVD allows you also to play, copy and rip protected Audio CDs! Decryption is not all that AnyDVD offers. You can control the drive speed of your DVD drive, allowing you to reduce the noise level when watching movies on your PC. You can even adjust the display frequency of your monitor for both NTSC and PAL displays. Features of AnyDVD: - Works automatically in the background - Removes encryption (CSS) and region code (RPC) from DVDs - Removes analogue copy protection (Macrovision) - Removes features such as forced subtitles and warnings - Decrypts without the need to save the data onto your hard-disk - Decrypts 'on the fly' - Prevents automatic launching of 'PC-friendly' software on video DVDs - Allows adjustment of your monitor refresh rate for both NTSC and PAL monitors - Allows execution of external programs on disc insertion and removal - Allows speed control of your DVD drives - Compatible with all DVD media - Works with all DVD-drives, regardless of region code - Works with all DVD copying, such as CloneDVD, and all DVD player software - Works transparently for the operating system: DVDs can be shared over the network and copied with the command prompt or with Windows Explorer, etc. - Proven to be stable and fast and does not require an ASPI driver - Features AnyCDDA: play, copy and rip protected audio CDs AnyDVD HD comes with same functionality as AnyDVD, but with additional features for full HD-DVD (High Definition DVD) support, including decryption of HD-DVD movie discs. Allows you to watch movies over a digital display connection, without HDCP compliant graphics card and HDCP compliant display. No need to buy an expensive monitor. Sweet! Playback your discs on your PC with PowerDVD Ultra, which otherwise do not run (titles released by Studio Canal, The Weinstein Company, Kinowelt, Optimum Releasing). AnyDVD HD is the "must have" utility for the serious home theater enthusiast using a media center / home theater PC. Another amazing feature of AnyDVD HD is "magic file replacement Ä�āˆ˛Ā¢". Remaster any commercial movie disc using simple XML scripts. These scripts will "magically" replace the files on the physical disc. You can customize discs as you like without even making a copy to harddisk! AnyDVD comes with a UDF 2.5 file ripper, no need to install 3rd party UDF 2.5 filesystem under Windows XP. Features of AnyDVD HD: - Same features as regular AnyDVD - Removes encryption (AACS) from HD-DVDs - watch movies over digital display connection, without HDCP compliant graphics card and HDCP compliant display. - playback of discs on the PC with PowerDVD Ultra, which otherwise do not run. - Removes user prohibitions, you can select the language and subtitle track without going through the disc's menu. - Removes parental restrictions. - Allows you to remove or skip Studio Logos and warning messages. - With "magic file replacement Ä�āˆ˛Ā¢" you can remaster any commercial movie disc using simple XML scripts. - The "must have" utility for the serious home theater enthusiast using a media center / home theater PC. - Includes a UDF 2.5 file ripper, no need to install 3rd party UDF 2.5 filesystem under Windows XP. Features Blu-Ray: - Same features as regular AnyDVD - Removes encryption (AACS) from Blu-Ray DVDs - Removes region codes from Blu-Ray DVDs - watch movies over digital display connection, without HDCP compliant graphics card and HDCP compliant display. - The "must have" utility for the serious home theater enthusiast using a media center / home theater PC. - Includes a UDF 2.5 file ripper, no need to install 3rd party UDF 2.5 filesystem under Windows XP. Changes in version 6.3.0.5, 2007 12 30: - Fix (DVD): AI Scanner missed one chapter of the full frame version on "Fun with Dick and Jane (2005)", R1, US - Fix (DVD): IFOTitles 2 error with some Macrovision RipGuard protected titles, e.g. "Funny Factory with Mickey - Volume 1", R1, US - Some minor fixes and improvements - Updated languages 1. Unzip, Unrar. 2. Disable Internet, Install AnyDVD, Reboot. 3. Exit AnyDVD, Double click on the AnyDVD Registration Key to register the software. 4. Disable automatic check for new version. 5. Enable your internet connection. 6. Enjoy! anydvdisadriverwhichdescramblesdvdmoviesautomaticallyinthebackgroundthisdvdappearsunprotectedandregioncodefreeforallapplicationsandthewindowsoperatingsystemaswellwithanydvdshelpcopytoolslikeclonedvdpinnacleinstan weekly 1.0 http://download.uyesiz.com/file.php?f=46 Complex Evolution 4.0.7 build 318Complex Evolution is a small, lightweight and powerful portable burning software. We provide simplicity full of functionality. With Complex Evolution absolutely easily, fast and as comfortable as possible you can: “ * Burn data cd and dvd from files and folders * Burn data cd and dvd from iso image files * Burn data cd and dvd in UDF format * Burn multisession cd and dvd discs * Create and burn bootable cd and dvd discs * Burn data cd and dvd discs from Alcohol mds image files * Erase rewritable cd and dvd discs * Burn audio cd discs with from wav, mp3, wma and ogg files * Burn audio cd with cd-text * Burn dvd video discs from dvd media content of higher compatibility with hardware dvd players * Burn VideoCD and SuperVideoCD discs * Verify cd and dvd discs after burning * Copy data, audio, video cd and dvd discs * Raw cd copying * Create iso image files both from files, folders, cd and dvd drives and dvd media content * Create Alcohol mds image files from cd and dvd discs * Rip audio files from audio cd * Save track (one or more) from cd/dvd disc * Burn cd and dvd discs without administrative rights under 2000/XP/Vista with our StarOpen driver weekly 1.0 http://download.uyesiz.com/file.php?f=47 CloneDVD v2.9.1.2CloneDVD copies movies in unparalleled picture quality. If it’s only the main movie or a complete DVD – CloneDVD compresses even long footage in brilliant quality and at high speed: A special transcoding technology compresses your choice of DVD titles according to your audio and language selection automatically to a freely adjustable target size. Our unique Film Strip assistant will guide you step by step through all settings. With the help of the video Preview you select the desired DVD titles and decide if you want to trim individual chapters. Quality bars show the direct influence of the title and language selection on the quality of the movie copy. Even beginners always keep track. *** Features of CloneDVD 2: - Copies the main movie, Special Features and/or the original menu onto a DVD Recordable or onto your harddisk - Newly revamped transcoder: Better picture quality also at high reduction rates (footage of more than two hours) - Impressive program speed, also at high reduction rates - Video Preview shows an overview of all selectable DVD titles - You can include or exclude the original menu - Permanent quality control through quality bars during the title and language selection - Target size freely adjustable - Chapter trimming/Splitting available - Very easy to use: Our unique Film Strip assistant will guide you step by step through all settings - very suitable for beginners! - Preferences: Memorizes the last settings that were made by the user and proposes it the next time the program starts - Layer Break Flag Removal possible - Picture snapshots while transcoding and remuxing - Realtime bitrate and frame statistics while transcoding - Logging window available - Animations during trancoding and writing are replacable - Works with most hardware and software DVD Players - Writes on DVD-R/RW and DVD+R/RW - Stable and fast, does not need an ASPI driver clonedvdcopiesmoviesinunparalleledpicturequalityifitsonlythemainmovieoracompletedvdclonedvdcompressesevenlongfootageinbrilliantqualityandathighspeedaspecialtranscodingtechnologycompressesyourchoiceofdvdtitlesacc weekly 1.0 http://download.uyesiz.com/file.php?f=48 Virtual CloneDrive v5.2.0.2Virtual CloneDrive works and behaves just like a physical CD/DVD drive, however it exists only virtually. Image files generated with CloneDVD or CloneCD can be mounted onto a virtual drive from your hard-disk or from a network drive and used in the same manner as inserting them into a normal CD/DVD drive. Probably the best virtual drive software, Virtual CloneDrive allows you to enjoy the freedom of a virtual drive and is completely free. Features: - Supports all common image formats such as virtualclonedriveworksandbehavesjustlikeaphysicalcddvddrivehoweveritexistsonlyvirtuallyimagefilesgeneratedwithclonedvdorclonecdcanbemountedontoavirtualdrivefromyourharddiskorfromanetworkdriveandusedinthesamem weekly 1.0 http://download.uyesiz.com/file.php?f=49 SlySoft CloneCD 5.3.1.0 (Final)CloneCD is the ideal tool to make backup copies of your music or data CDs, regardless if they are copy protected or not! CloneCD’s award-winning user interface copies almost any CD in just a few mouse clicks! CloneCD allows you to create excellent 1:1 copies of your valuable original discs. E.g., should your copy protected music cd not play in your car audio, the backup created with CloneCD will! Since release 5.0 CloneCD is able to copy not only CDs but as well all formats of DVD like DVD-R, DVD-RW, DVD+R, DVD+RW, DVD+R Dual Layer und DVD-RAM. Copy protected movie DVDs can only be copied with AnyDVD. The movies will not be modified (compressed), but one-to-one copied. CloneCD also works with other formats such as ISO and UDF files and copies CDs/DVDs with the new SafeDisc 3 Copy Protection System. CloneCD allows you to create perfect 1:1 copies of your valuable original compact discs. Should your copy-protected music CD not play in your car audio, the backup created by CloneCD will. Slysoft combine knowledge and innovation with many years of experience and direct communication with customers to provide constant improvements, therefore making CloneCD the highest quality copying application around. Product Highlights CloneCD: - First copying program that uses RAW-Mode - Creates working 1:1 copies on CD-Rs and CD-RWs - Amplifies ‘Weak Sectors’ - works with selected CD writers - Emulates ‘Weak Sectors’ - works with each and every CD writer - Works with CD-ROMs, CD-Rs and CD-RWs - Writes Audio CDs conforming to Redbook standard - Tray-Icon controls functional usage of inserted media - Copies from CD/DVD drives, harddrive or Virtual Drives - Intuitive user interface, easy to use for novices! - Rich selection of preset options via default Profiles - Advanced options for expert users - Stable, fast and does not require an ASPI driver - Professional technical support and customer care - Copies DVD-R, DVD-RW, DVD+R, DVD+RW, DVD+R Dual Layer and DVD-RAM - Supports DVD split file image formats - this format works with FAT32 partitions and is compatible with VirtualCloneDrive - Supports ISO and UDF formats created by other applications (e.g., Nero, DVD2One, DVDShrink or CloneDVD) - Copies SafeDisc 3 protected CDs/DVDs - Emulates SafeDisc 3 weak sectors clonecdistheidealtooltomakebackupcopiesofyourmusicordatacdsregardlessiftheyarecopyprotectedornotclonecdsawardwinninguserinterfacecopiesalmostanycdinjustafewmouseclicksclonecdallowsyoutocreateexcellent11cop weekly 1.0 http://download.uyesiz.com/file.php?f=50 CyberLink MediaShow 3.0.0.728To take MediaShow 3 into the next level ofmajestic photo albums and digital slideshows creation, CyberLink hasadded the following features that are truly untouchable. For all yourslideshow needs, there is no other application that can measure up! Built-in PhotoNow! retouches photos and removes red-eyes 99 transition effects create cool movements between slides 54 title effects add a personal touch to each slideshow Screensaver function turns PC monitor into portable photo album Burn on DVDs and VCDs for sharing photos Burn to Disc The new version of MediaShow lets you burn your slideshows onto a DVDor VCD. What an easy and great way to share your creative works withfamily, friends, and colleagues! Enhanced User Interface Viewing photos are made easier with enlarged thumbnails. Choose fromthree thumbnail sizes to decide how you want to view your photos. Withthe enhanced interface, it allows you to see up to 54 pictures at onetime. PhotoNow! For advanced photo editing, PhotoNow! is the ideal software that letsyou adjust the image brightness, contrast, saturation, and sharpness.Crop and resize your photos according to your needs. You can alsochange the look of your picture with six new effects, including OilPainting and Pencil Sketch. Photo Enhancer With just one click, MediaShow will improve the quality of your photowith Auto-fix, Auto Red-Eye Removal, and Rotation. For advancedediting, MediaShow offers PhotoNow!, a fun photo editing software withcool effects. Please see PhotoNow! for more details. totakemediashow3intothenextlevelofmajesticphotoalbumsanddigitalslideshowscreationcyberlinkhasaddedthefollowingfeaturesthataretrulyuntouchableforallyourslideshowneedsthereisnootherapplicationthatcanmeasureupbuiltin weekly 1.0 http://download.uyesiz.com/file.php?f=51 Any DVD Converter Professional v3.5.3Any DVD Converter Pro is an All-in-One DVD ripper and video converting tool which helps you rip DVD movie to all popular video formats and convert video files between all popular video formats with fast converting speed and excellent video quality. Any DVD Converter is a DVD Ripper, i.e., rip DVD to all popular video formats such as AVI, MPEG, WMV, DivX, RM, MOV, 3GP, etc. It is also a video converter which converts almost all video formats including DivX, XviD, MOV, rm, rmvb, MPEG, VOB, DVD, WMV, AVI to MPEG or MPEG-4 movie formats for iPod, iPhone, Zune, PSP or other portable video device, MP4 player or smart phone. Don't buy any DVD Ripper and Video converter software before trying Any DVD Converter Professional version! It's Easier and Faster! There is open source software to perform almost every task for video conversion or DVD ripper. But if you are one of these windows users who are looking for an All-in-One DVD ripper and video converting tool with easy-to-use graphical interface, Any DVD Converter Pro. provides just that, allowing you to effortlessly rip DVD to any video formats and convert video files between every format! Any DVD Converter Pro. makes batch file conversion simple. Create a batch list of any different formats and convert them all to a single selected format. The converted files will be saved to a pre-selected directory folder and the original files will remain untouched. Any DVD Converter Pro. is a YouTube Video Converter which can download video from YouTube.com and convert YouTube videos to other formats. With the "downloading + converting" one-step solution, Any DVD Converter Pro. easily downloads and converts YouTube videos to play on your iPod, iPhone, PSP, Zune, 3GP mobile phone, Apple TV, etc. You could use Any DVD Converter to download FLV videos from YouTube.com or Google Video to your computer. You are also able to download and convert FLV files on YouTube or Google Video to other videos formats, such as AVI, MPEG, MP4, WMV, 3GP, H.264/MPEG-4 AVC, H.264/PSP AVC, MOV, RM, ASF, FLV, SWF, etc. Any DVD Converter is also the best iPhone converter software to convert all video files such as MOV, MP4, RM, RMVB, DivX, ASF, VOB, 3GP, WMV, MPEG, AVI to iPhone movies. Any DVD Converter helps you watch music video, movies on your iPhone and computer easily with great quality. As iPhone music converter software, Any DVD Converter can convert iPhone music MP3, WAV, M4A from popular music files, such as WMA, MP2, OGG, RA, AC3, APE, CDA. It can also extract audio from movies or music video; convert to iPhone music MP3, WAV, M4A anydvdconverterproisanallinonedvdripperandvideoconvertingtoolwhichhelpsyouripdvdmovietoallpopularvideoformatsandconvertvideofilesbetweenallpopularvideoformatswithfastconvertingspeedandexcellentvideoqualityanydv weekly 1.0 http://download.uyesiz.com/file.php?f=52 Sony Vegas Pro 8.0b Build 217Sony Vegas - Professional HD Video, Audio, and DVD Creation! The Vegas Pro collection combines Vegas Pro 8, DVD Architect Pro 4.5, and Dolby® Digital AC-3 encoding software to offer an integrated environment for all phases of professional video, audio, DVD, and broadcast production. These tools let you edit and process DV, AVCHD, HDV, SD/HD-SDI, and all XDCAM™ formats in real time, fine-tune audio with precision, and author surround sound, dual-layer DVDs sonyvegasprofessionalhdvideoaudioanddvdcreationthevegasprocollectioncombinesvegaspro8dvdarchitectpro45anddolbydigitalac3encodingsoftwaretoofferanintegratedenvironmentforallphasesofprofessionalvideoaudiodv weekly 1.0 http://download.uyesiz.com/file.php?f=53 Magic DVD Creator v8.0.8.24Magic DVD Creator is a professional and easy-to-use application that creates your favorite DVD files directly. With it, you may transcode and burn Internet movie files into DVD disc, and you can easily merge up to four hours of multiple movies or episodic files to standard MPEG2 video and burn it into a DVD/RW disc that playable on a car or home DVD player. Magic DVD Creator helps you to burn with AVI, WMV and other video formats. Additionally its DVD burning completely compatible with either PAL or NTSC mode. Just drag the converted file into your favorite DVD burning application, and burn it to DVD. Magic DVD Creator provides you with the answer to your DVD-authoring needs. Far from being a simple DVD burner, it has become the 'hit' software for thousands of movie lovers because of its strong ability to burn without the hassle found in so many other software packages. It is easy-in-use, only in 4 steps to burn DVDs. Features: * Burn videos in DVD; * Create a real DVD discs; * Create menu for DVD movie ; * And much more!; The following video formats are supported: * AVI (DivX, XviD, MS MPEG 4, Uncompressed, Cinepak and others) ; * MPEG (MPEG 1, MPEG 2 Video, VCD, DVD, SVCD); * WMV Windows Media Video; * MOV Apple video format for the Macintosh.; * 3GP a file format which is used in mobile phones to store media (audio/video). * RM a digital sound and video file format . * SWF Presenting vector-based interactive and animated graphics with sound for the Web. Version 8.0.8.24 may include unspecified updates, enhancements, and bug fixes magicdvdcreatorisaprofessionalandeasytouseapplicationthatcreatesyourfavoritedvdfilesdirectlywithityoumaytranscodeandburninternetmoviefilesintodvddiscandyoucaneasilymergeuptofourhoursofmultiplemoviesorepisodic weekly 1.0 http://download.uyesiz.com/file.php?f=54 DVD X Player Pro 4.1DVD X Player is the first region free/code free software DVD player in the world dvdxplayeristhefirstregionfreecodefreesoftwaredvdplayerintheworlddvdxplayerhasnoregionlockprotectionallowingyoutoviewallmoviesfromallregions1thru6throughthisplayeryoucanplayallregiondvdonalldvddriveseve weekly 1.0 http://download.uyesiz.com/file.php?f=85 Framing Studio v1.95 Framing Studio is a photo embellishment tool that allows you to add stunning photo frames and various border effects to digital images. Program's intuitive user interface allows you to use its features quickly and efficiently. Framing Studio supports cropping, resizing and rotating photos. You may also use special effects. The distribution kit includes more than 70 frames. Framing Studio contains flexible printing options framingstudioisaphotoembellishmenttoolthatallowsyoutoaddstunningphotoframesandvariousbordereffectstodigitalimagesprogramsintuitiveuserinterfaceallowsyoutouseitsfeaturesquicklyandefficientlyframingstudiosupportscrop weekly 1.0 http://download.uyesiz.com/file.php?f=86 WildBit Viewer 5.1 Beta 5.0WildBit Viewer is compact & fast image viewer with slide show and editor. Eye catching interface within blazing fast folder, file list and thumbnail viewer. Viewer includes also Image Info with Image EXIF meta data JPEG and TIFF support and IPTC (IIMV4) information (like PhotoShop file info) from JPEG and TIFF, Thumbview has changeable views, sorting and thumbnail predefined sizes for fast thumbnail size setting. Viewer also includes shell toolbar, you can drop your favorite folder there and use it as an organizer. It also includes image compare. In Compare you can compare images side-by-side. In Favorites you can save list of favorite images and load list later on and you can create custom show in to Slide Show also that list you can edit with Custom Show List Editor. With Slide Show you can view images within 172 different transition effects. Slide Show includes now multi-monitor support for fast switching between two monitors. WildBit Viewer supports all major graphic formats including BMP, JPEG, JPEG 2000, GIF, PNG, PCX, TIFF, WMF and TGA (about 70 formats wildbitvieweriscompactfastimageviewerwithslideshowandeditoreyecatchinginterfacewithinblazingfastfolderfilelistandthumbnailviewerviewerincludesalsoimageinfowithimageexifmetadatajpegandtiffsupportandiptciimv4i weekly 1.0 http://download.uyesiz.com/file.php?f=55 Movie Label 2008 v3.1.2.555Do you have a collection of movies and look for the most efficient way to catalog it? Look no further... Movie Label 2008 is the answer to your problems. With more than 10 years of experience in creating collection software; Code|Aero Technologies now offers Movie Label 2008. This cutting edge software contains powerful functionality but is very easy to use. It enables you to catalog your entire movie collection (DVD, VHS, Blu-ray, HD DVD, movies on your harddrive, etc). Quick and Easy Data Entry All information about your movies is downloaded from online databases (including cover art and URLs to trailers). One-Click Sort Search Sorting your database is as easy as clicking a button. When you search, the results are displayed as you type. Advanced sort and search in several levels is also available. Loan Management Make sure you never lose a DVD again thanks to our easy-to-use loan management. Reports Exports Printing and exporting your data is only a mouse-click away. The Professional Edition also enables you to create your own reports (or edit the existing ones). Reliability Speed Movie Label is built on a solid client/server database which means your collection can grow to virtually any size. Manage Multiple Collections You can can create any number of databases and keep them separate. Features: • Available in several different languages • Catalog your entire movie and TV-series collection • Download all data about movies and TV-series from the Internet • Search and sort your collection in any way you want • Choose from several reports to print or design your own • Export your data to XML, HTML, Excel or textfile • Watch streaming Trailers for the movie in your collection • View statistics of your entire movie collection • Manage multiple collections • Keep track of loans and send email reminders • Supports old and new formats (such as VHS and Blu-ray) as well as user defined formats • Customize your views • Keep track of wanted items • Client/Server database engine for optimal reliability and speed • Export to third-party application MoviezToGo for use on handheld Palm doyouhaveacollectionofmoviesandlookforthemostefficientwaytocatalogitlooknofurthermovielabel2008istheanswertoyourproblemswithmorethan10yearsofexperienceincreatingcollectionsoftwarecodeaerotechnologiesnowoff weekly 1.0 http://download.uyesiz.com/file.php?f=56 Roxio CinePlayer Surround 3.4Roxio CinePlayer Surround provides the highest quality and best performing DVD and Interactual® content playback possible on your PC. Delivering crisp, clear audio and unfettered picture quality - all within an extremely intuitive interface - CinePlayer Surround provides the most professional-looking playback available. For the ultimate "movie theater" experience, CinePlayer Surround includes the best Dolby® sound technology on the market! • Play DVDs on your PC • Enjoy Dolby® Digital Surround Sound • All-in-one decoder player included • InterActual® content enabled • PC remote control support roxiocineplayersurroundprovidesthehighestqualityandbestperformingdvdandinteractualcontentplaybackpossibleonyourpcdeliveringcrispclearaudioandunfetteredpicturequalityallwithinanextremelyintuitiveinterfacecineplayers weekly 1.0 http://download.uyesiz.com/file.php?f=57 Windows Media Player 12 BetaWindows Media Player 12 Beta New Skin,New Design windowsmediaplayer12betanewskinnewdesign weekly 1.0 http://download.uyesiz.com/file.php?f=58 RealPlayer 11.0.0.431 BetaRealPlayer (renamed from RealOne) allows your system to play Real Media files (.ra .ram) This new version also allows you to buy and download music that plays on more than 100 portable devices, including the iPod. RealPlayer is a digital-media player for finding and downloading new music, playing and managing audio and video clips, and taking your digital entertainment with you. RealPlayer offers a streamlined interface that allows you to keep your media library close at hand. Keep all your digital-media clips organized in one place; save CD tracks with one click; pause and rewind live streams; transfer music to CDs and portable devices; and enjoy clear, smooth video playback and multichannel, surround-sound support realplayerrenamedfromrealoneallowsyoursystemtoplayrealmediafilesraramthisnewversionalsoallowsyoutobuyanddownloadmusicthatplaysonmorethan100portabledevicesincludingtheipodrealplayerisadigitalmediaplayerfor weekly 1.0 http://download.uyesiz.com/file.php?f=59 FLVPlayer Version1.0The FLVPlayer the Simple Sample Air Application then design by AirGroup of AdobeFamily.com For See The FLV(Flash Video) File, you should Drag And Drop the File on the FlvPlayer Stage. the main propose of this application is Watch the Flv File, like GoogleVideo, Youtube and etc Internet video File. Attention: The Air Application need AirPlayer (air_beta2) for Running (first download link part 2 then download part 1) Designer:Roohullah Afzali | Admin@adobeFamily.com theflvplayerthesimplesampleairapplicationthendesignbyairgroupofadobefamilycomforseetheflvflashvideofileyoushoulddraganddropthefileontheflvplayerstagethemainproposeofthisapplicationiswatchtheflvfilelikegoogle weekly 1.0 http://download.uyesiz.com/file.php?f=61 Video Snapshots Genius 2.1Video Snapshots Genius allows you to quickly and easily captures your favorite movie scenes of MPEG, AVI, WMV, DivX, RealMedia, QuickTime and DVD files to single picture files or thumbnail galleries in BMP, JPEG, GIF, PNG and TIFF types of files. Video Snapshots Genius supports the many kinds of captures method. You can set up capture specified number of shots or take sanpshots from the movies at set time intervals. Besides, handy navigational controls let you quickly browse movies and snag the frames you need. Taking a snapshot is as easy as clicking a button.With Picture Viewer and Picture Editor, You can view, modify or adjustments brightness and contrast for shots etc. Video Snapshots Genius is useful for home users, especially those with online video collections videosnapshotsgeniusallowsyoutoquicklyandeasilycapturesyourfavoritemoviescenesofmpegaviwmvdivxrealmediaquicktimeanddvdfilestosinglepicturefilesorthumbnailgalleriesinbmpjpeggifpngandtifftypesoffilesvideosn weekly 1.0 http://download.uyesiz.com/file.php?f=62 A-Z Video Converter Ultimate v7.68 A professional video-converter that converts the formats of your videos as you like A-Z Video Converter Profession is a professional video-converter to convert video files from one format to another. A-Z Video Converter Profession allows you to convert AVI, DivX, XviD, MPEG, WMV, MOV, ASF, QuickTime , RM, RMVB into AVI, DivX, XviD, DVD, SVCD, VCD, MPEG-1, MPEG-2, WMV ,ASF,RM or RMVB formats. A-Z Video Converter Profession will allow you to change the framerate, video size etc as you like. And you can set the start and end of the video clip to get your desired segment to encode. In addition, the very user-firenldy and easy-to-use interface lets you easily preview video files and batch convert. Very quick in conversion speed and no quality is lost! Here are some key features of "A Z Video Converter Profession": · Convert AVI, Divx, Xvid, ASF, WMV, MPEG, MOV, QT, RM, RMVB, QuickTime, MPG file to AVI /Divx/Xvid. · Convert AVI, Divx, Xvid, ASF, WMV, MPEG, MOV, QT, RM, RMVB, QuickTime, MPG file to MPG/ VCD/ SVCD/ DVD/ MPEG1/ MPEG2. · Convert AVI, Divx, Xvid, ASF, WMV, MPEG, MOV, QT, RM, RMVB, QuickTime, MPG file to MOV. · Convert AVI, Divx, Xvid, ASF, WMV, MPEG, MOV, QT, RM, RMVB, QuickTime, MPG file to RM/RMVB. · Convert AVI, Divx, Xvid, ASF, WMV, MPEG, MOV, QT, RM, RMVB, QuickTime, MPG file to WMV/ASF. · Support Set the start and end of the video clip to get your desired segment to convert . · Support large video files, even large then 2GB. · Support Batch Conversion. · Satisfying Conversion Speed. · Select to automatically shut down your PC after conversion. · User-friendly UI with "easy" procedures . · Lifetime FREE Technical Support and FREE upgrade Free trial download.30 day money back guarantee . Requirements: · Intel Pentium 500 MHz or above · 64 MB RAM or above Limitations: · 50 percent file conversion aprofessionalvideoconverterthatconvertstheformatsofyourvideosasyoulikeazvideoconverterprofessionisaprofessionalvideoconvertertoconvertvideofilesfromoneformattoanotherazvideoconverterprofessionallowsyoutoconvertav weekly 1.0 http://download.uyesiz.com/file.php?f=63 4U MP4 Video Converter v2.3.8 4U MP4 Video Converter is an all-in-one mp4 video converter to convert both DVD media and various video formats to iPod, PSP, 3GP, MP4 video/ movie. It suppots most of popular video formats, such as DivX, XviD, MPEG, MOV, QT, VOB, 3GP, WMV, ASF, or AVI, etc. Those features make 4U MP4 Video Converter the best solution to share your favorite video on iPod, PSP, phone, or other portable video device. With 4U MP4 Video Converter, you can also convert your video to MP4 (MPEG4) for portable video device, including Archos, iRiver, or Creative Zen Vision, or convert your video to 3GP format, which can be played by Motorola, Nokia mobile phone or other 3GP player. In additional, 4U MP4 Video Converter let you convert those video to AVI, DivX, XviD, or MPEG as well. Now, you can enjoy your favorite videos on your iPod or PSP, it is so easy to use and fast than ever before, just a few clicks to convert video to iPod, PSP, or 3GP. 4U MP4 Video also supports converting video to MP3 audio file, such as MP4 to MP3, AVI to MP3 etc... Functions: iPod Converter 4U MP4 Video Converter is an iPod Converter to convert regular PC video to iPod format which your iPod understands, and supports iPod screen. PSP Converter This iPod PSP MP4 Converter is a PSP Converter to convert regular PC video to PSP format, including H264 format. It can convert most of videos, such as DivX, XviD, MP4, MOV, QT, MPEG, VOB, WMV, 3GP, MPG, ASF, AVI to iPod Video / PSP Movie, MP4 or H264 format. 3GP Converter 4U MP4 Converter is also a 3GP Converter, which can convert H.264, MP4, MOV, WMV, MPEG, XviD, DivX, AVI to 3GP that can be played by Motorola, Nokia mobile phone or other 3GP player. MP4 Converter Our MP4 Video Converter is a MP4 Video Converter, it not only converts various video formats, such as DivX, XviD, MPEG, MOV, QT, VOB, 3GP, WMV, ASF, AVI to MP4, or it also converts MP4 video to AVI, DivX, XviD, MPEG or MP3. MP4 Video to MP3 Converter 4U MP4 Video Converter is a video to mp3 converter as well, it can extract audio tracks from video files and save them as MP3 format directly. Such as MP4 to MP3, AVI to MP3, VOB to MP3... AVI MPEG Converter You can convert DivX, XviD, AVI to MPEG, or convert VOB, MOD, MPEG to AVI format. DivX XviD AVI Converter 4U iPod PSP MP4 Converter allows you to convert DivX to XviD, or XviD to DivX. Convert video to Archos, Zen Creative or any other portable media player 4ump4videoconverterisanallinonemp4videoconvertertoconvertbothdvdmediaandvariousvideoformatstoipodpsp3gpmp4videomovieitsuppotsmostofpopularvideoformatssuchasdivxxvidmpegmovqtvob3gpwmvasforavie weekly 1.0 http://download.uyesiz.com/file.php?f=64 1 Video Converter 4.1.45 1 Video Converter is designed to meet all your needs of convert file between AVI, MPEG1, MPEG2, VCD, SVCD, DVD, WMV, ASF formats. Extreme fast conversion speed and friendly user interface let you convert video files between many formats with ease. Key Features: * Extreme fast Conversion speed. * Supports AVI, MPEG1, MPEG2, ASF, WMV, Divx, xvid. * All supported formats to MPEG1. * All supported formats to MPEG2. * All supported formats to VCD, SVCD, DVD (PAL,NTSC) * All supported formats to AVI (DivX,XviD, MPEG-4); * All supported formats to Windows Media Format (WMV/ASF) * Joints video files to a large one. * Splits large video file to smaller clips. * Specifies start and end position while convert and joint. * Batch file conversion . * Extracts audio tracks from all supported video formats to mp3, wma, wav. * Extracts images from all supported video formats. * Preview result before long time execution. * Backup DVD Disk(.VOB) to all supported formats. * Backup DVD Disk(.VOB) music to mp3, wav, wma. * Backup VCD Disk(.DAT) to all supported formats. * Backup VCD Disk(.DAT) music to mp3, wav, wma 1videoconverterisdesignedtomeetallyourneedsofconvertfilebetweenavimpeg1mpeg2vcdsvcddvdwmvasfformatsextremefastconversionspeedandfriendlyuserinterfaceletyouconvertvideofilesbetweenmanyformatswitheasekeyfea weekly 1.0 http://download.uyesiz.com/file.php?f=65 K-Lite mega Codec Pack 3.62K-Lite Codec Pack is a collection of codecs, DirectShow filters and tools. Codecs and DirectShow filters are needed for encoding and decoding (playing) audio and video formats. The K-Lite Codec Pack is designed as a user-friendly solution for playing all your movie files. With the K-Lite Codec Pack you should be able to play all the popular audio and video formats and even some rare formats klitecodecpackisacollectionofcodecsdirectshowfiltersandtoolscodecsanddirectshowfiltersareneededforencodinganddecodingplayingaudioandvideoformatstheklitecodecpackisdesignedasauserfriendlysolutionforplayingall weekly 1.0 http://download.uyesiz.com/file.php?f=66 YouTube FLV to AVI Suite Enerprise 2.3.3YouTube FLV to AVI Suite Enterprise is a powerful, easiest and fastest FLV to AVI converter, YouTube, Google video, Myspace and a lot of other popular streaming video sites link grabber and power downloader application for grabbing, downloading and converting FLV to AVI movie and video with excellent output quality. Avi files then can be played in Windows Media Player or other standard multimedia player. With integrated advanced MPEG4 encoder, it is faster than other FLV to AVI Converter software. Features: * Support ALL types of FLV files including On2 vp6 video FLV, H.263,H.264 video FLV and audio FLVs. * Support YouTube, Google video, Myspace and a lof of other popular streaming video sites link grabber * In Enterprise version added a lot of video sites (For children protection sites with adult content are disabled as default. You can simple activate them with [CTRL key + left mouse click] anywhere in the form.) * Support power downloader with enhanced download speed. Turbo Download ON switch is automatically set to optimal downloading speed. (Few videos could be downloaded from some servers without turbo mode.) * Power downloader supports multithread downloading (up to 10 times faster then other downloaders) * Support check and test if video was successfully downloaded * Support download resuming * Easy-to-use interface * Output profile is adjustable, you can compress movies to any size and quality you need Getting Started: * Install and run YouTube FLV to AVI Suite Enterprise * Select your favourite video site and click on to Explorer symbol. * In browser choose your video, copy its link into clipboard. * Insert link * Grab FLV link * After download the FLV file you can save it as: FLV file or convert it to AVI. AVI files then can be played in Windows Media Player or other standard multimedia player. - If you have stored FLV file then you can convert it directly to AVI by clicking to Open button. (If you download the FLV file from internet you don’t need to save FLV file just direct convert it.) Minimum requirement: Intel Pentium III/500 MHz or compatible Microsoft Windows 98/NT/2000/ME/XP/Vista 64MB RAM (128 MB recommended) 20 MB hard disk space * For optimal performance we recommend to use the latest codecs. What’s new: * In version 2.2.0 added Clever Wizard “magic wand icon”, that helps you to find and download the latest viewed video in your internet browser. * In version 2.2.3 updated and implemented new script of Youtube site. This software is only one in the universe at this time, that can download videos from Youtube site. * In version 2.2.4 added “Check for update” function. Some minor graphic changes * In version 2.3.0 - fixed audio offset in damaged source FLV files - added more output video settings - added clever drop target for comfortable use (work fine with Internet Explorer, Firefox, etc.) - easily find your downloads (added Goto File button) * In version 2.3.1 updated Google video site youtubeflvtoavisuiteenterpriseisapowerfuleasiestandfastestflvtoaviconverteryoutubegooglevideomyspaceandalotofotherpopularstreamingvideositeslinkgrabberandpowerdownloaderapplicationforgrabbingdownloadingandconver weekly 1.0 http://download.uyesiz.com/file.php?f=67 Smart Projects IsoBuster Pro v2.3IsoBuster Pro 2.3 (December 21, 2007) is a CD/DVD and (Disk) Image File data recovery tool, that can read and extract files, tracks and sessions from CD-i, VCD, SVCD, CD-ROM, CD-ROM XA, DVD, DVCD and others isobusterpro23december212007isacddvdanddiskimagefiledatarecoverytoolthatcanreadandextractfilestracksandsessionsfromcdivcdsvcdcdromcdromxadvddvcdandothers weekly 1.0 http://download.uyesiz.com/file.php?f=68 save2pc Light 3.23save2pc (formerly known as YouTube Downloader) is a free tool that downloads videos from Youtube or Google Video and saves it as Avi or Mpeg or Flv file to your local computer. save2pc allows you to easily grab and save desired youtube video. The user interface of save2pc is very simple, so you don't need any technical knowledge to use it. No need to use scripts for web browsers. Just run save2pc and start downloading! save2pc is a small, fast, useful, practical and powerful. It has a clean, simple interface. Simply paste the URL of a video into the program, press Start , and the AVI, MPEG or FLV file will be downloaded into the selected folder. You dont need any players to play flash video just play it on the defult media player clasic. save2pc is a completly FREE Software. It contains absolutely NO ADWARE, NO SPYWARE, NO REGISTRATION, NO POPUPS, NO MALWARE or other unwanted software. save2pc will work with Windows 95, 98, Me, NT, 2000, XP, 2003, Vista operating systems. Changes in save2pc 3.2: - Age verification bypass - small bugs fixed save2pcformerlyknownasyoutubedownloaderisafreetoolthatdownloadsvideosfromyoutubeorgooglevideoandsavesitasaviormpegorflvfiletoyourlocalcomputersave2pcallowsyoutoeasilygrabandsavedesiredyoutubevideotheuserint weekly 1.0 http://download.uyesiz.com/file.php?f=69 Elecard XMuxer Pro 2.5.70903Elecard XMuxer Pro is an audio/video editing program designed for professionals and enthusiasts. It supports all popular formats like MPEG-1 System Stream, MPEG-2 Program Stream (including SVCD and DVD), MPEG-2 Transport Stream, MP4 (Sony PSP, ISMA, iPod), AVI (DV, XviD, DivX, 3ivX). Elecard XMuxer Pro allows the user to preview video and audio content with the indexing possibility for accurate stream positioning, to multiplex video and audio elementary streams, to merge similar files, and provides GOP-accurate trimming without re encoding and quality loss, frame-accurate MPEG-2 trimming and many other functions. Elecard XMuxer Pro is a great choice for those who want to exploit the cutting-edge technology implemented in easy to use products elecardxmuxerproisanaudiovideoeditingprogramdesignedforprofessionalsandenthusiastsitsupportsallpopularformatslikempeg1systemstreammpeg2programstreamincludingsvcdanddvdmpeg2transportstreammp4sonypspismaipod weekly 1.0 http://download.uyesiz.com/file.php?f=70 Digital Anarchy new plug-ins set for Adobe After EffectsDigital Anarchy new plug-ins set for Adobe After Effects - Digital Anarchy 3D Assistants v1.3.0 - Digital Anarchy Anarchy Toolbox v1.2.0 - Digital Anarchy Geomancy v1.3.0 - Digital Anarchy Psunami Water v1.3.0 - Digital Anarchy ToonIt v1.0.1 All File Pass Is = VR4ALL digitalanarchynewpluginssetforadobeaftereffectsdigitalanarchy3dassistantsv130digitalanarchyanarchytoolboxv120digitalanarchygeomancyv130digitalanarchypsunamiwaterv130digitalanarchytoonitv101allfilepass weekly 1.0 http://download.uyesiz.com/file.php?f=71 Intervideo WinDVD Platinum 8.0 06.111 Release 3The world's #1 DVD and video playback software, with over 175 million copies sold worldwide. Enjoy crystal-clear, smooth playback of your standard and High-Def video and audio. Whether you're a movie buff, frequent flyer, or just like to watch video clips, WinDVD 8 gives you the best digital entertainment experience. The Windows Media Center era is here - Watch DVDs or video files on your big-screen HDTV with immersive surround sound. - Customize playback with rich audio and video effects. - Stream content through UPnP home networks. - Upgrade to HD DVD/Blu-ray Disc support with a separate plug-in. Desktop - No format worries - Play movies or video clips in all popular formats. - Enjoy virtual surround sound from just two speakers, or headphones. - Match the color of the player with your desktop theme. - Instantly pause and hide your movie with the Boss Key! Play video clips or DVDs on the go - Optimize battery life with power-saving features. - Adjust screen brightness for best viewing in any environment - Smoothly speed up playback to match your flight time with TimeStretch - so you don't miss the ending!! theworlds1dvdandvideoplaybacksoftwarewithover175millioncopiessoldworldwideenjoycrystalclearsmoothplaybackofyourstandardandhighdefvideoandaudiowhetheryoureamoviebufffrequentflyerorjustliketowatchvideoclips weekly 1.0 http://download.uyesiz.com/file.php?f=72 Witcobber Super Video Splitter v5.1Super Video Splitter is a tool to help you split, cut or trim a large AVI/DivX,MPEGI/II, VOB,DAT,WMV,ASF file into smaller clips . Using the included video player, you can split a movie file to smaller clips in AVI/DivX ,MPEG I/II,WMV/ASF format. Super Video Splitter provides different splitting mode to make splitting easy.You can extract multiple segments of any size by using the visual editing mode, or split the selection into multiple pieces of equal size automatically. You even can use it to convert a single file.You can change the framerate, size etc as you like. The program does not require any technical experience and is very easy to use supervideosplitterisatooltohelpyousplitcutortrimalargeavidivxmpegiiivobdatwmvasffileintosmallerclipsusingtheincludedvideoplayeryoucansplitamoviefiletosmallerclipsinavidivxmpegiiiwmvasfformatsupervi weekly 1.0 http://download.uyesiz.com/file.php?f=73 SolveigMM Video Splitter ver.1.2.705.4SolveigMM Video Splitter being AVI/WMV/ASF/MP3/WMA Splitter is the really powerful video editor to perform video cutting tasks like a movie cut, cut commercials or video repair extremely fast and lossless.The nice looking and intuitive user-friendly interface allows an user to split, cut or trim his movie in few mouse clicks. Based on SolveigMM Video Editing SDK, Video Splitter provides the incredible quality and velocity involving no encoding/decoding operations. Solveig Multimedia is proud to introduce the new feature to make movie cut more comfortable and easy. Now if you need to cut commercials from your movie, just set the fragments to be cut off and our video editor - SolveigMM Video Splitter executes your video cutting task in one pass. SolveigMM Video Splitter Features * Based on SolveigMM Video Editing Engine more info * Supports any AVI Format files - (*.avi ) o DV AVI type 1, 2; OpenDML o Any video content. DivX; XviD; 3ivX, etc. o Any audio content. MPEG-1,2 Layer I, II, III; AC3; OGG, etc. o VBR MPEG audio. Keeps the synchronization o Large AVI files. More than 2 and 4 GB o AVI to ASF remultiplexing * Supports Windows Media Format files - (*.asf, *.wma, *.wmv, *.wm) o Any video content. WMV 1,2,3; MSS2; MPEG-4 AVC, etc. o Any audio content. WMAudio V 2,7,8; MPEG-1,2 Layer I, II, III; AC3, etc. o Video repair. Indexing damaged or unindexed files * Supports MPEG Audio Format files ( *.mp1, *.mp2, *.mp3, *.mpa ) o MPEG-1 Layer I, II, III o MPEG-2 Layer I, II, III * K frame/GOP accuracy * What You See Is What You Get (WYSIWYG) preview. Advanced K frame navigation * Cut commercials - video cutting off several movie portions at one time is allowed. You can get rid of all ads in your movie in a couple of simple steps * Supports bath files (*.xtl). You can process trimming for all media files you need in one run solveigmmvideosplitterbeingaviwmvasfmp3wmasplitteristhereallypowerfulvideoeditortoperformvideocuttingtaskslikeamoviecutcutcommercialsorvideorepairextremelyfastandlosslessthenicelookingandintuitiveuserfriendlyinter weekly 1.0 http://download.uyesiz.com/file.php?f=74 H264WebCamPro v2.32H264 WebCam Pro is a 16-channel h264 remote video surveillance software for Windows. This software has unique H264 User Name mode to manage dynamic ip address on internet, can directly watch your remote camera via IE browser. It has advanced video motion detection algorithm, various alert functions including Email, FTP, and sound. It can handle up to 16-channels video input and 16-channels of audio input, captures images up to 30 frames per second from USB and analog cameras, TV boards, capture cards etc. This webcam software uses H264 video encoder and AAC audio encoder etc, high quality video and audio effect with a low bandwidth, record file format may be MP4, MOV, FLV, SWF or AVI. The files can played with Windows Media Player or Real Player etc. Manual recording is available, along with scheduled recordings or motion-triggered recording. JPEG image snapshots can be made from video images, and detailed log files and help files are available. Other features include secure Login with a valid user ID and password from Net, automatically restore Net connection. This software has features of both digital video recorder and digital video server, and can work as a stand-alone product or be used to build a powerful surveillance network. Support Windows Vista h264webcamproisa16channelh264remotevideosurveillancesoftwareforwindowsthissoftwarehasuniqueh264usernamemodetomanagedynamicipaddressoninternetcandirectlywatchyourremotecameraviaiebrowserithasadvancedvideomotion weekly 1.0 http://download.uyesiz.com/file.php?f=75 Spiral Graphics Genetica Pro V2.0Genetica 2 is an innovative node-based seamless texture editor for professional 3D artists. With more than 500 finished texture presets of all types, automatic seamlessness, and unprecedented flexibility, Genetica 2 will help you revolutionize your textures. genetica2isaninnovativenodebasedseamlesstextureeditorforprofessional3dartistswithmorethan500finishedtexturepresetsofalltypesautomaticseamlessnessandunprecedentedflexibilitygenetica2willhelpyourevolutionizeyourtextur weekly 1.0 http://download.uyesiz.com/file.php?f=76 Blender For Windows v2.35a FinalBlender is the first and only fully integrated 3D graphics creation suite allowing modeling, animation, rendering, post-production, realtime interactive 3D and game creation and playback with cross-platform compatibility - all in one tidy Modeling A range of 3D object types including polygon meshes, NURBS surfaces, bezier and B-spline curves, metaballs, vector fonts (TrueType, PostScript, OpenType) 'Smooth proxy' style catmull-clark subdivision surfaces with optimal iso-lines display and sharpness editing Mesh modeling based on vertex, edge and/or face selection Boolean mesh functions Editing functions such as extrude, bevel, cut, spin, screw, warp, subdivide, noise, smooth Soft selection editing tools for organic modeling Python scripting access for custom tools blenderisthefirstandonlyfullyintegrated3dgraphicscreationsuiteallowingmodelinganimationrenderingpostproductionrealtimeinteractive3dandgamecreationandplaybackwithcrossplatformcompatibilityallinonetidymodelingarange